
Wikipedia se
Jump to navigation Jump to search

Original file(SVG file, naam kare ke khatir 87 × 87 pixels, file size: 41 KB)

Ii file Wikimedia Commons se aais hai aur duusra projects me bhi kaam me lawa jaae sake hai. Iske baare me aur jaankari file description page ke niche dekhawa jaae hai.

Baare me

An icon for science stubs on :en.

Taarik 2004-11-28; 2008-02-14
Source en:Image:Science-symbol2.png
Likhe waala en:User:AllyUnion, User:Stannered
(Reusing this file)

The original image has been released into the public domain by its author, AllyUnion, at the English Wikipedia project. I, the creator of this derivative work, hereby release my modifications under the following licenses:

w:en:Creative Commons
This file is licensed under the Creative Commons Attribution 3.0 Unported license.
You are free:
  • share kare ke khaatir – to copy, distribute and transmit the work
  • to remix – to adapt the work
II condition ke niiche:
  • attribution – You must attribute the work in the manner specified by the author or licensor (but not in any way that suggests that they endorse you or your use of the work).

GNU head Permission is granted to copy, distribute and/or modify this document under the terms of the GNU Free Documentation License, Version 1.2 or any later version published by the Free Software Foundation; with no Invariant Sections, no Front-Cover Texts, and no Back-Cover Texts. A copy of the license is included in the section entitled GNU Free Documentation License.
Other versions

Derivative works of this file: Wikinews Ciência.png en:Image:Science-symbol2.png

Cafkfkcjdkckdkckdkcskckskfkdkckdkckdllapwpgodlcmdkfkdkckdkfkckgkdkfkdkdkskdifkfkfkgkdkfkfkfkdkfkfkslglqwefkckdkgkkgtegory:Created with Inkcnsncndkckdscape Caxmvkdkcktegory:Bohr model icons

File ke itihaas

File ke dekhe khatir, jaise uu time dekhe me lagat rahaa, date/time pe click karo.

Din/TimeChhota chapaLambai aur chauraiSadasyaTiprrin
abhi waala21:08, 14 February 200821:08, 14 February 2008 waala version ke chhota chapa87 × 87 (41 KB)Stannered{{Information |Description=An icon for science stubs on :en. |Source=en:Image:Science-symbol2.png |Date=2004-11-28; 2008-02-14 |Author=en:User:AllyUnion, User:Stannered |Permission=The original image has been released into the public domain

Global file usage